PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00012077-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SRS
Protein Properties Length: 313aa    MW: 34833.5 Da    PI: 7.6732
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00012077-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702223.25.2e-69902464154
              DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.........aeaaskrkrelkskkqsa 85 
                         g+++CqdCGnqakkdC+h RCRtCCksrgf+C+thvkstWvpaakrrerq+qlaa++++ ++++         + +++kr+r++ +  ++ 
  WALNUT_00012077-RA  90 GGMNCQDCGNQAKKDCSHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQEQLAALQQQLQQQQdqhqeqqhfRGENPKRQRDN-QLGAAP 179
                         789***************************************************998887766655666655555555555554.555667 PP

              DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         l++t++++++s   le  ++P+ev+s+avfrcvrv++++d +e++aYqtav+igGhvfkGiLydqG e+
  WALNUT_00012077-RA 180 LACTRIPNTTSG--LERGQFPAEVNSPAVFRCVRVGAMEDPDEQYAYQTAVNIGGHVFKGILYDQGRED 246
                         889999988765..88899***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-6691245IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-2693135IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-26196243IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAGFFYLGGR EGPQNKQEEE EKQENSQFLY RNEEIYNKGF EIWPQYYQQQ QNMSNYYSFG  60
VGPSRRNLNS VSDESSRSGL TLIRQGGVGG GMNCQDCGNQ AKKDCSHLRC RTCCKSRGFQ  120
CQTHVKSTWV PAAKRRERQE QLAALQQQLQ QQQDQHQEQQ HFRGENPKRQ RDNQLGAAPL  180
ACTRIPNTTS GLERGQFPAE VNSPAVFRCV RVGAMEDPDE QYAYQTAVNI GGHVFKGILY  240
DQGREDRYTT VGESSSGGDG GGVQPLNFIT AATTTTTTAT TSTPSATLLD PSLFPAPLNA  300
FMAGTQFFPP PRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017677.11e-139SHI-related sequence 7, putative
SwissprotQ9LQZ52e-94SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A061FDV11e-139A0A061FDV1_THECC; SHI-related sequence 7, putative
STRINGPOPTR_0002s03000.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.17e-74SHI-related sequence 5